PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g034120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 207aa    MW: 24457.9 Da    PI: 6.6452
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g034120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.3e-2055110257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +kR  +++eq++ Le+ F  ++++  e++++LA++lgL+  qV vWFqN+Ra++k+
  Sopim03g034120.0.1  55 KKRKLLSEEQVNLLERSFGDEHKLEMERKAKLASELGLDPHQVAVWFQNKRARWKN 110
                         89****************************************************95 PP

2HD-ZIP_I/II106.91.5e-3456146292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         k++ ls+eqv+lLE+sF  e+kLe erK++la+eLgl+p+qvavWFqn+RAR+k+k+lE++y++Lk++++    e+ rLe+ev +++e+l 
  Sopim03g034120.0.1  56 KRKLLSEEQVNLLERSFGDEHKLEMERKAKLASELGLDPHQVAVWFQNKRARWKNKKLEEEYSKLKTQHELTIIEKYRLESEVLKMKEQLF 146
                         555689*********************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.92551111IPR001356Homeobox domain
SMARTSM003892.6E-1853115IPR001356Homeobox domain
SuperFamilySSF466891.37E-1755119IPR009057Homeodomain-like
CDDcd000866.92E-1455112No hitNo description
PfamPF000466.5E-1755110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-2056118IPR009057Homeodomain-like
PRINTSPR000317.9E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000317.9E-691107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MTSSKVDDQM ELISHFYPHI YAQLAQQQGE TVKPRRRRKK NEIEGRNNTS EVVMKKRKLL  60
SEEQVNLLER SFGDEHKLEM ERKAKLASEL GLDPHQVAVW FQNKRARWKN KKLEEEYSKL  120
KTQHELTIIE KYRLESEVLK MKEQLFEAQK EIERLLLEHK SDISSNNSPT SSIFSMEQPH  180
FDLGELILEG QLMDDNMLFN ITLWDN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13757RKKNEIEGRNNTSEVVMKKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234615.11e-150PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU701e-58ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BFT41e-150K4BFT4_SOLLC; Uncharacterized protein
STRINGSolyc03g034120.2.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-57homeobox protein 40